Lineage for d2fama_ (2fam A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717506Species Slug sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 1717512Domain d2fama_: 2fam A: [15154]
    complexed with hem, scn

Details for d2fama_

PDB Entry: 2fam (more details), 2 Å

PDB Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2fama_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fama_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaagk

SCOPe Domain Coordinates for d2fama_:

Click to download the PDB-style file with coordinates for d2fama_.
(The format of our PDB-style files is described here.)

Timeline for d2fama_: