Lineage for d2fam__ (2fam -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 591Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 597Domain d2fam__: 2fam - [15154]

Details for d2fam__

PDB Entry: 2fam (more details), 2 Å

PDB Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states

SCOP Domain Sequences for d2fam__:

Sequence, based on SEQRES records: (download)

>d2fam__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaagk

Sequence, based on observed residues (ATOM records): (download)

>d2fam__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOP Domain Coordinates for d2fam__:

Click to download the PDB-style file with coordinates for d2fam__.
(The format of our PDB-style files is described here.)

Timeline for d2fam__: