![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.2: Reverse transcriptase [56686] (3 proteins) |
![]() | Protein MMLV reverse transcriptase [56687] (1 species) |
![]() | Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries) Uniprot P03355 RE 144-594 |
![]() | Domain d2r2ta_: 2r2t A: [151539] automated match to d1d0ea_ protein/DNA complex; protein/RNA complex |
PDB Entry: 2r2t (more details), 2 Å
SCOPe Domain Sequences for d2r2ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r2ta_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq kqvkylgyllkegqr
Timeline for d2r2ta_: