Lineage for d2r2ra1 (2r2r A:24-278)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884437Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 884660Protein MMLV reverse transcriptase [56687] (1 species)
  7. 884661Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 884672Domain d2r2ra1: 2r2r A:24-278 [151537]
    automatically matched to d1d0ea_

Details for d2r2ra1

PDB Entry: 2r2r (more details), 2.1 Å

PDB Description: d(attagttataactaat) complexed with mmlv rt catalytic fragment
PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d2r2ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2ra1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

SCOP Domain Coordinates for d2r2ra1:

Click to download the PDB-style file with coordinates for d2r2ra1.
(The format of our PDB-style files is described here.)

Timeline for d2r2ra1: