Lineage for d2r2la1 (2r2l A:54-368)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775631Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 775632Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 775633Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 775680Species Rat (Rattus norvegicus) [TaxId:10116] [48442] (29 PDB entries)
    Uniprot Q04631 55-369
  8. 775686Domain d2r2la1: 2r2l A:54-368 [151535]
    Other proteins in same PDB: d2r2lb1
    automatically matched to d1o1ra_
    complexed with fpp, pb9, zn

Details for d2r2la1

PDB Entry: 2r2l (more details), 2.23 Å

PDB Description: structure of farnesyl protein transferase bound to pb-93
PDB Compounds: (A:) Farnesyltransferase subunit alpha

SCOP Domain Sequences for d2r2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r2la1 a.118.6.1 (A:54-368) Protein farnesyltransferase alpha-subunit {Rat (Rattus norvegicus) [TaxId: 10116]}
gflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrders
erafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrr
vlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrn
nsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsryp
nllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirk
eywryigrslqskhs

SCOP Domain Coordinates for d2r2la1:

Click to download the PDB-style file with coordinates for d2r2la1.
(The format of our PDB-style files is described here.)

Timeline for d2r2la1: