SCOPe 2.05: Domain d2r29l1: 2r29 L:112-213

Lineage for d2r29l1 (2r29 L:112-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d2r29l1: 2r29 L:112-213 [151534]
   Other proteins in same PDB: d2r29a_, d2r29l2
   automated match to d1c12a2
   protein/RNA complex

Details for d2r29l1

PDB Entry: 2r29, 3 Å

PDB Description: neutralization of dengue virus by a serotype cross-reactive antibody elucidated by cryoelectron microscopy and x-ray crystallography

PDB Compounds: (L:) Light chain of Fab 1A1D-2

SCOPe Domain Sequences for d2r29l1:

Sequence, based on SEQRES records:

>d2r29l1 b.1.1.2 (L:112-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Sequence, based on observed residues (ATOM records):

>d2r29l1 b.1.1.2 (L:112-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppssltsggasvvcflnnfypkdinvkwkidrqngvlnswtdqdstysm
sstltltkdeyerhnsytceatspivksfnrne

Timeline for d2r29l1:

• d2r29l1 first appeared in SCOP 1.75
  
• d2r29l1 appears in SCOPe 2.04
  
• d2r29l1 appears in SCOPe 2.06
  
• d2r29l1 appears in the current release, SCOPe 2.08