Lineage for d2r29l1 (2r29 L:112-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2753390Domain d2r29l1: 2r29 L:112-213 [151534]
    Other proteins in same PDB: d2r29a_, d2r29h_, d2r29l2
    automated match to d1c12a2
    protein/RNA complex

Details for d2r29l1

PDB Entry: 2r29 (more details), 3 Å

PDB Description: neutralization of dengue virus by a serotype cross-reactive antibody elucidated by cryoelectron microscopy and x-ray crystallography
PDB Compounds: (L:) Light chain of Fab 1A1D-2

SCOPe Domain Sequences for d2r29l1:

Sequence, based on SEQRES records: (download)

>d2r29l1 b.1.1.2 (L:112-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Sequence, based on observed residues (ATOM records): (download)

>d2r29l1 b.1.1.2 (L:112-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppssltsggasvvcflnnfypkdinvkwkidrqngvlnswtdqdstysm
sstltltkdeyerhnsytceatspivksfnrne

SCOPe Domain Coordinates for d2r29l1:

Click to download the PDB-style file with coordinates for d2r29l1.
(The format of our PDB-style files is described here.)

Timeline for d2r29l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r29l2