SCOPe 2.08: Domain d2r29a_: 2r29 A:

Lineage for d2r29a_ (2r29 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d2r29a_: 2r29 A: [151533]
   Other proteins in same PDB: d2r29h_, d2r29l1, d2r29l2
   automated match to d1tgea1
   protein/RNA complex

Details for d2r29a_

PDB Entry: 2r29, 3 Å

PDB Description: neutralization of dengue virus by a serotype cross-reactive antibody elucidated by cryoelectron microscopy and x-ray crystallography

PDB Compounds: (A:) Envelope protein E

SCOPe Domain Sequences for d2r29a_:

Sequence; same for both SEQRES and ATOM records:

>d2r29a_ b.1.18.4 (A:) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d2r29a_:

• d2r29a_ first appeared in SCOP 1.75, called d2r29a1
  
• d2r29a_ appears in SCOPe 2.07