SCOPe 2.07: Domain d2r25b_: 2r25 B:

Lineage for d2r25b_ (2r25 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (9 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187251] (1 PDB entry)

8. Domain d2r25b_: 2r25 B: [151530]
   Other proteins in same PDB: d2r25a_
   automated match to d1oxkb_
   complexed with bef, mg, na

Details for d2r25b_

PDB Entry: 2r25, 1.7 Å

PDB Description: complex of ypd1 and sln1-r1 with bound mg2+ and bef3-

PDB Compounds: (B:) Osmosensing histidine protein kinase SLN1

SCOPe Domain Sequences for d2r25b_:

Sequence; same for both SEQRES and ATOM records:

>d2r25b_ c.23.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsvkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdv
qmpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklkti
ltefcaayqgkkn

Timeline for d2r25b_:

• d2r25b_ first appeared in SCOP 1.75, called d2r25b1
  
• d2r25b_ appears in SCOPe 2.06
  
• d2r25b_ appears in the current release, SCOPe 2.08