SCOPe 2.06: Domain d1dm1a_: 1dm1 A:

Lineage for d1dm1a_ (1dm1 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Slug sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)

8. Domain d1dm1a_: 1dm1 A: [15153]
   complexed with hem; mutant

Details for d1dm1a_

PDB Entry: 1dm1, 1.99 Å

PDB Description: 2.0 a crystal structure of the double mutant h(e7)v, t(e10)r of myoglobin from aplysia limacina

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1dm1a_:

Sequence; same for both SEQRES and ATOM records:

>d1dm1a_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangdaflvalfekfpdsanffadfkgksvadikaspkl
rdhsstiftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaagk

Timeline for d1dm1a_:

• d1dm1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1dm1a_ appears in SCOPe 2.05
  
• d1dm1a_ appears in SCOPe 2.07
  
• d1dm1a_ appears in the current release, SCOPe 2.08