Lineage for d1dm1a_ (1dm1 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 43963Family a.1.1.2: Globins [46463] (17 proteins)
  6. 44499Protein Myoglobin [46469] (9 species)
  7. 44557Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 44561Domain d1dm1a_: 1dm1 A: [15153]

Details for d1dm1a_

PDB Entry: 1dm1 (more details), 1.99 Å

PDB Description: 2.0 a crystal structure of the double mutant h(e7)v, t(e10)r of myoglobin from aplysia limacina

SCOP Domain Sequences for d1dm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm1a_ a.1.1.2 (A:) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangdaflvalfekfpdsanffadfkgksvadikaspkl
rdhsstiftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaagk

SCOP Domain Coordinates for d1dm1a_:

Click to download the PDB-style file with coordinates for d1dm1a_.
(The format of our PDB-style files is described here.)

Timeline for d1dm1a_: