SCOPe 2.07: Domain d2r1ub_: 2r1u B:

Lineage for d2r1ub_ (2r1u B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein DJ-1 [89603] (1 species)
   RNA-binding protein regulatory subunit

7. Species Human (Homo sapiens) [TaxId:9606] [89604] (62 PDB entries)
   Uniprot Q99497

8. Domain d2r1ub_: 2r1u B: [151528]
   automated match to d1pdva_

Details for d2r1ub_

PDB Entry: 2r1u, 1.5 Å

PDB Description: dj-1 activation by catechol quinone modification

PDB Compounds: (B:) Protein DJ-1

SCOPe Domain Sequences for d2r1ub_:

Sequence; same for both SEQRES and ATOM records:

>d2r1ub_ c.23.16.2 (B:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

Timeline for d2r1ub_:

• d2r1ub_ first appeared in SCOP 1.75, called d2r1ub1
  
• d2r1ub_ appears in SCOPe 2.06
  
• d2r1ub_ appears in the current release, SCOPe 2.08