| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
| Protein P22 C2 repressor, DNA-binding domain [47426] (1 species) |
| Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries) contains a short additional helix at C-terminus |
| Domain d2r1jr_: 2r1j R: [151526] automated match to d1adra_ protein/DNA complex |
PDB Entry: 2r1j (more details), 1.53 Å
SCOPe Domain Sequences for d2r1jr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1jr_ a.35.1.2 (R:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd
Timeline for d2r1jr_: