Lineage for d2r1jl_ (2r1j L:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087132Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1087133Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1087154Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1087216Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)
  7. 1087217Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (5 PDB entries)
    contains a short additional helix at C-terminus
  8. 1087218Domain d2r1jl_: 2r1j L: [151525]
    automated match to d1adra_
    protein/DNA complex

Details for d2r1jl_

PDB Entry: 2r1j (more details), 1.53 Å

PDB Description: crystal structure of the p22 c2 repressor protein in complex with the synthetic operator 9t
PDB Compounds: (L:) Repressor protein C2

SCOPe Domain Sequences for d2r1jl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1jl_ a.35.1.2 (L:) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]}
tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd
yllkgd

SCOPe Domain Coordinates for d2r1jl_:

Click to download the PDB-style file with coordinates for d2r1jl_.
(The format of our PDB-style files is described here.)

Timeline for d2r1jl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2r1jr_