Class a: All alpha proteins [46456] (284 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein P22 C2 repressor, DNA-binding domain [47426] (1 species) |
Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (2 PDB entries) contains a short additional helix at C-terminus |
Domain d2r1jl1: 2r1j L:3-68 [151525] automatically matched to d1adra_ |
PDB Entry: 2r1j (more details), 1.53 Å
SCOP Domain Sequences for d2r1jl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1jl1 a.35.1.2 (L:3-68) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22 [TaxId: 10754]} tqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcspd yllkgd
Timeline for d2r1jl1: