SCOP 1.75: Domain d2r1gi1: 2r1g I:2-126

Lineage for d2r1gi1 (2r1g I:2-126)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (3 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
   contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension

6. Protein Ribosomal protein S13 [46948] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
   Uniprot P80377

8. Domain d2r1gi1: 2r1g I:2-126 [151524]
   Other proteins in same PDB: d2r1gg1, d2r1gh1
   automatically matched to d1fjgm_

Details for d2r1gi1

PDB Entry: 2r1g, 12.5 Å

PDB Description: coordinates of the thermus thermophilus 30s components neighboring rbfa as obtained by fitting into the cryo-em map of a 30s-rbfa complex

PDB Compounds: (I:) 30S ribosomal protein S13

SCOP Domain Sequences for d2r1gi1:

Sequence; same for both SEQRES and ATOM records:

>d2r1gi1 a.156.1.1 (I:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

Timeline for d2r1gi1:

• d2r1gi1 is new in SCOP 1.75
  
• d2r1gi1 appears in SCOPe 2.01
  
• d2r1gi1 appears in the current release, SCOPe 2.08