Lineage for d2r1gi1 (2r1g I:2-126)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779264Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 779265Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 779266Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
  6. 779267Protein Ribosomal protein S13 [46948] (2 species)
  7. 779295Species Thermus thermophilus [TaxId:274] [46949] (44 PDB entries)
    Uniprot P80377
  8. 779335Domain d2r1gi1: 2r1g I:2-126 [151524]
    Other proteins in same PDB: d2r1gg1, d2r1gh1
    automatically matched to d1fjgm_

Details for d2r1gi1

PDB Entry: 2r1g (more details), 12.5 Å

PDB Description: coordinates of the thermus thermophilus 30s components neighboring rbfa as obtained by fitting into the cryo-em map of a 30s-rbfa complex
PDB Compounds: (I:) 30S ribosomal protein S13

SCOP Domain Sequences for d2r1gi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1gi1 a.156.1.1 (I:2-126) Ribosomal protein S13 {Thermus thermophilus [TaxId: 274]}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

SCOP Domain Coordinates for d2r1gi1:

Click to download the PDB-style file with coordinates for d2r1gi1.
(The format of our PDB-style files is described here.)

Timeline for d2r1gi1: