Lineage for d2r1gh1 (2r1g H:5-128)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1711001Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries)
  8. 1711201Domain d2r1gh1: 2r1g H:5-128 [151523]
    Other proteins in same PDB: d2r1gg1, d2r1gi1
    automatically matched to d1gixo_
    protein/RNA complex

Details for d2r1gh1

PDB Entry: 2r1g (more details), 12.5 Å

PDB Description: Coordinates of the thermus thermophilus 30S components neighboring RbfA as obtained by fitting into the CRYO-EM map of A 30S-RBFA complex
PDB Compounds: (H:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2r1gh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1gh1 i.1.1.1 (H:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d2r1gh1:

Click to download the PDB-style file with coordinates for d2r1gh1.
(The format of our PDB-style files is described here.)

Timeline for d2r1gh1: