SCOP 1.75: Domain d2r1gh1: 2r1g H:5-128

Lineage for d2r1gh1 (2r1g H:5-128)

1. Root: SCOP 1.75

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)

8. Domain d2r1gh1: 2r1g H:5-128 [151523]
   Other proteins in same PDB: d2r1gg1, d2r1gi1
   automatically matched to d1gixo_

Details for d2r1gh1

PDB Entry: 2r1g, 12.5 Å

PDB Description: coordinates of the thermus thermophilus 30s components neighboring rbfa as obtained by fitting into the cryo-em map of a 30s-rbfa complex

PDB Compounds: (H:) 30S ribosomal protein S12

SCOP Domain Sequences for d2r1gh1:

Sequence; same for both SEQRES and ATOM records:

>d2r1gh1 i.1.1.1 (H:5-128) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

Timeline for d2r1gh1:

• d2r1gh1 is new in SCOP 1.75
  
• d2r1gh1 appears in SCOPe 2.01
  
• d2r1gh1 appears in the current release, SCOPe 2.08