Lineage for d2r1gg1 (2r1g G:2-128)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852984Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 852985Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 852986Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 853092Protein Ribosomal protein S9 [54218] (2 species)
  7. 853120Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 853155Domain d2r1gg1: 2r1g G:2-128 [151522]
    Other proteins in same PDB: d2r1gh1, d2r1gi1
    automatically matched to d1fjgi_

Details for d2r1gg1

PDB Entry: 2r1g (more details), 12.5 Å

PDB Description: coordinates of the thermus thermophilus 30s components neighboring rbfa as obtained by fitting into the cryo-em map of a 30s-rbfa complex
PDB Compounds: (G:) 30S ribosomal protein S9

SCOP Domain Sequences for d2r1gg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1gg1 d.14.1.1 (G:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d2r1gg1:

Click to download the PDB-style file with coordinates for d2r1gg1.
(The format of our PDB-style files is described here.)

Timeline for d2r1gg1: