Lineage for d3mbaa_ (3mba A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (10 species)
  7. 1978212Species Slug sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 1978216Domain d3mbaa_: 3mba A: [15152]
    complexed with f, hem

Details for d3mbaa_

PDB Entry: 3mba (more details), 2 Å

PDB Description: aplysia limacina myoglobin. crystallographic analysis at 1.6 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3mbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOPe Domain Coordinates for d3mbaa_:

Click to download the PDB-style file with coordinates for d3mbaa_.
(The format of our PDB-style files is described here.)

Timeline for d3mbaa_: