Class b: All beta proteins [48724] (174 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) |
Family b.29.1.4: Laminin G-like module [49944] (6 proteins) |
Protein Ligand-binding domain of neurexin 1beta [49949] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (4 PDB entries) |
Domain d2r1df1: 2r1d F:36-212 [151518] automatically matched to d1c4rg_ complexed with ca |
PDB Entry: 2r1d (more details), 2.6 Å
SCOP Domain Sequences for d2r1df1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1df1 b.29.1.4 (F:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv
Timeline for d2r1df1: