Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) possible distant homologue of the type I KH domain lacking the KH motif automatically mapped to Pfam PF02033 |
Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (1 protein) |
Protein Ribosome-binding factor A, RbfA [89921] (5 species) |
Species Thermus thermophilus [TaxId:274] [160239] (2 PDB entries) Uniprot Q5SJV1 4-94 |
Domain d2r1ca1: 2r1c A:5-94 [151512] automatically matched to 2DYJ A:4-94 protein/RNA complex |
PDB Entry: 2r1c (more details), 12.5 Å
SCOPe Domain Sequences for d2r1ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r1ca1 d.52.7.1 (A:5-94) Ribosome-binding factor A, RbfA {Thermus thermophilus [TaxId: 274]} kahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsr aerrlvaalarrvrmrrlprleflpwrasp
Timeline for d2r1ca1: