Lineage for d2r1ca1 (2r1c A:5-94)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947415Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (2 families) (S)
    possible distant homologue of the type I KH domain lacking the KH motif
    automatically mapped to Pfam PF02033
  5. 2947416Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (2 proteins)
  6. 2947417Protein Ribosome-binding factor A, RbfA [89921] (5 species)
  7. 2947426Species Thermus thermophilus [TaxId:274] [160239] (2 PDB entries)
    Uniprot Q5SJV1 4-94
  8. 2947429Domain d2r1ca1: 2r1c A:5-94 [151512]
    automatically matched to 2DYJ A:4-94
    protein/RNA complex

Details for d2r1ca1

PDB Entry: 2r1c (more details), 12.5 Å

PDB Description: coordinates of the thermus thermophilus ribosome binding factor a (rbfa) homology model as fitted into the cryo-em map of a 30s-rbfa complex
PDB Compounds: (A:) ribosome-binding factor a

SCOPe Domain Sequences for d2r1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r1ca1 d.52.7.1 (A:5-94) Ribosome-binding factor A, RbfA {Thermus thermophilus [TaxId: 274]}
kahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalralsr
aerrlvaalarrvrmrrlprleflpwrasp

SCOPe Domain Coordinates for d2r1ca1:

Click to download the PDB-style file with coordinates for d2r1ca1.
(The format of our PDB-style files is described here.)

Timeline for d2r1ca1: