Lineage for d2r17b_ (2r17 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998354Family d.159.1.7: YfcE-like [111233] (5 proteins)
  6. 2998372Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)
  7. 2998376Species Human (Homo sapiens) [TaxId:9606] [160872] (5 PDB entries)
  8. 2998386Domain d2r17b_: 2r17 B: [151511]
    automated match to d1w24a1
    complexed with gol

Details for d2r17b_

PDB Entry: 2r17 (more details), 2.8 Å

PDB Description: functional architecture of the retromer cargo-recognition complex
PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d2r17b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r17b_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]}
mmlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhiv
rgdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkf
eafehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkveriey
kkp

SCOPe Domain Coordinates for d2r17b_:

Click to download the PDB-style file with coordinates for d2r17b_.
(The format of our PDB-style files is described here.)

Timeline for d2r17b_: