Lineage for d5mbaa_ (5mba A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1717376Protein Myoglobin [46469] (9 species)
  7. 1717506Species Slug sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 1717509Domain d5mbaa_: 5mba A: [15151]
    complexed with azi, hem

Details for d5mbaa_

PDB Entry: 5mba (more details), 1.9 Å

PDB Description: binding mode of azide to ferric aplysia limacina myoglobin. crystallographic analysis at 1.9 angstroms resolution
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5mbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOPe Domain Coordinates for d5mbaa_:

Click to download the PDB-style file with coordinates for d5mbaa_.
(The format of our PDB-style files is described here.)

Timeline for d5mbaa_: