Lineage for d5mba__ (5mba -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 530467Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 530468Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 530506Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 531553Protein Myoglobin [46469] (9 species)
  7. 531618Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 531621Domain d5mba__: 5mba - [15151]
    complexed with azi, hem

Details for d5mba__

PDB Entry: 5mba (more details), 1.9 Å

PDB Description: binding mode of azide to ferric aplysia limacina myoglobin. crystallographic analysis at 1.9 angstroms resolution

SCOP Domain Sequences for d5mba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mba__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOP Domain Coordinates for d5mba__:

Click to download the PDB-style file with coordinates for d5mba__.
(The format of our PDB-style files is described here.)

Timeline for d5mba__: