Lineage for d2r0wh_ (2r0w H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (23 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (610 PDB entries)
  8. 2745075Domain d2r0wh_: 2r0w H: [151509]
    Other proteins in same PDB: d2r0wl2
    automated match to d6shgh_
    complexed with na

Details for d2r0wh_

PDB Entry: 2r0w (more details), 2.5 Å

PDB Description: pfa2 fab complexed with abeta1-8
PDB Compounds: (H:) IgG2a Fab fragment heavy chain, Fd portion

SCOPe Domain Sequences for d2r0wh_:

Sequence, based on SEQRES records: (download)

>d2r0wh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvtlkesgpgilkpsqtlsltcslsgfslrtsgmgvgwirqpsgkglewlahiwwdddkn
ynpslksqltiskdtsrnqvflkitsvdtadtatyycvrrahnvvlgdwfaywgqgtlvt
vsaakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavl
qsdlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d2r0wh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvtlkesgpgilkpsqtlsltcslsgfslrtsgmgvgwirqpsgkglewlahiwwdddkn
ynpslksqltiskdtsrnqvflkitsvdtadtatyycvrrahnvvlgdwfaywgqgtlvt
vsaakttapsvyplapvssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlyt
lsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d2r0wh_:

Click to download the PDB-style file with coordinates for d2r0wh_.
(The format of our PDB-style files is described here.)

Timeline for d2r0wh_: