Lineage for d2r0ua1 (2r0u A:2-276)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874505Protein Cell cycle checkpoint kinase chk1 [64404] (1 species)
    CaMK group; CAMKL subfamily; serine/threonine kinase
  7. 874506Species Human (Homo sapiens) [TaxId:9606] [64405] (35 PDB entries)
  8. 874517Domain d2r0ua1: 2r0u A:2-276 [151508]
    automatically matched to d1ia8a_
    complexed with m54

Details for d2r0ua1

PDB Entry: 2r0u (more details), 1.9 Å

PDB Description: Crystal Structure of Chek1 in Complex with Inhibitor 54
PDB Compounds: (A:) Serine/threonine-protein kinase Chk1

SCOP Domain Sequences for d2r0ua1:

Sequence, based on SEQRES records: (download)

>d2r0ua1 d.144.1.7 (A:2-276) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
lhkilvenpsaritipdikkdrwynkplkkgakrp

Sequence, based on observed residues (ATOM records): (download)

>d2r0ua1 d.144.1.7 (A:2-276) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]}
avpfvedwdlvqtlgegevqlavnrvteeavavkivdmknikkeicinkmlnhenvvkfy
ghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdi
kpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdv
wscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenps
aritipdikkdrwynkplkkgakrp

SCOP Domain Coordinates for d2r0ua1:

Click to download the PDB-style file with coordinates for d2r0ua1.
(The format of our PDB-style files is described here.)

Timeline for d2r0ua1: