Lineage for d2r0na2 (2r0n A:3-238)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883981Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 883982Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 883983Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)
  6. 884007Protein Glutaryl-CoA dehydrogenase GCDH [111293] (1 species)
  7. 884008Species Human (Homo sapiens) [TaxId:9606] [111294] (4 PDB entries)
    Uniprot Q92947
  8. 884010Domain d2r0na2: 2r0n A:3-238 [151507]
    Other proteins in same PDB: d2r0na1
    automatically matched to d1siqa2
    complexed with fad, tgc; mutant

Details for d2r0na2

PDB Entry: 2r0n (more details), 2.3 Å

PDB Description: The effect of a Glu370Asp mutation in Glutaryl-CoA Dehydrogenase on Proton Transfer to the Dienolate Intermediate
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOP Domain Sequences for d2r0na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0na2 e.6.1.1 (A:3-238) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
efdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelgvl
gptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqkylp
qlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvvwa
rcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgass

SCOP Domain Coordinates for d2r0na2:

Click to download the PDB-style file with coordinates for d2r0na2.
(The format of our PDB-style files is described here.)

Timeline for d2r0na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0na1