Lineage for d2r0na1 (2r0n A:239-392)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708369Protein Glutaryl-CoA dehydrogenase GCDH [109794] (1 species)
  7. 2708370Species Human (Homo sapiens) [TaxId:9606] [109795] (3 PDB entries)
    Uniprot Q92947
  8. 2708372Domain d2r0na1: 2r0n A:239-392 [151506]
    Other proteins in same PDB: d2r0na2
    automated match to d1sira1
    complexed with fad, tgc; mutant

Details for d2r0na1

PDB Entry: 2r0n (more details), 2.3 Å

PDB Description: The effect of a Glu370Asp mutation in Glutaryl-CoA Dehydrogenase on Proton Transfer to the Dienolate Intermediate
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2r0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0na1 a.29.3.1 (A:239-392) Glutaryl-CoA dehydrogenase GCDH {Human (Homo sapiens) [TaxId: 9606]}
lggpfgclnnarygiawgvlgasefclhtarqyaldrmqfgvplarnqliqkkladmlte
itlglhaclqlgrlkdqdkaapemvsllkrnncgkaldiarqardmlggngisdeyhvir
hamnleavntyegthdihalilgraitgiqafta

SCOPe Domain Coordinates for d2r0na1:

Click to download the PDB-style file with coordinates for d2r0na1.
(The format of our PDB-style files is described here.)

Timeline for d2r0na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0na2