SCOPe 2.08: Domain d2r0ma2: 2r0m A:3-238

Lineage for d2r0ma2 (2r0m A:3-238)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein automated matches [226961] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225392] (3 PDB entries)

8. Domain d2r0ma2: 2r0m A:3-238 [151505]
   Other proteins in same PDB: d2r0ma1
   automated match to d1siqa2
   complexed with 4ni, fad; mutant

Details for d2r0ma2

PDB Entry: 2r0m, 2.7 Å

PDB Description: the effect of a glu370asp mutation in glutaryl-coa dehydrogenase on proton transfer to the dienolate intermediate

PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d2r0ma2:

Sequence; same for both SEQRES and ATOM records:

>d2r0ma2 e.6.1.1 (A:3-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efdwqdplvleeqlttdeilirdtfrtycqerlmprillanrnevfhreiisemgelgvl
gptikgygcagvssvaygllarelervdsgyrsamsvqsslvmhpiyaygseeqrqkylp
qlakgellgcfgltepnsgsdpssmetrahynssnksytlngtktwitnspmadlfvvwa
rcedgcirgfllekgmrglsapriqgkfslrasatgmiimdgvevpeenvlpgass

Timeline for d2r0ma2:

• d2r0ma2 first appeared in SCOP 1.75
  
• d2r0ma2 appears in SCOPe 2.07