SCOPe 2.08: Domain d2r0lh2: 2r0l H:114-212

Lineage for d2r0lh2 (2r0l H:114-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Synthetic construct [TaxId:32630] [158874] (1 PDB entry)

8. Domain d2r0lh2: 2r0l H:114-212 [151503]
   Other proteins in same PDB: d2r0lh1
   automatically matched to d1uj3b2

Details for d2r0lh2

PDB Entry: 2r0l, 2.2 Å

PDB Description: short form hgfa with inhibitory fab75

PDB Compounds: (H:) antibody heavy chain, Fab portion only

SCOPe Domain Sequences for d2r0lh2:

Sequence; same for both SEQRES and ATOM records:

>d2r0lh2 b.1.1.2 (H:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Synthetic construct [TaxId: 32630]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

Timeline for d2r0lh2:

• d2r0lh2 first appeared in SCOP 1.75
  
• d2r0lh2 appears in SCOPe 2.07