Lineage for d2r0lh1 (2r0l H:1-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2344816Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2345794Species Synthetic construct [TaxId:32630] [158862] (3 PDB entries)
  8. 2345795Domain d2r0lh1: 2r0l H:1-113 [151502]
    Other proteins in same PDB: d2r0lh2
    automatically matched to d1uj3b1
    complexed with bma, nag

Details for d2r0lh1

PDB Entry: 2r0l (more details), 2.2 Å

PDB Description: short form hgfa with inhibitory fab75
PDB Compounds: (H:) antibody heavy chain, Fab portion only

SCOPe Domain Sequences for d2r0lh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0lh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Synthetic construct [TaxId: 32630]}
evqlvesggglvqpggslrlscaasgftisnsgihwvrqapgkglewvgwiyptggatdy
adsvkgrftisadtskntaylqmnslraedtavyycarfwwrsfdywgqgtlvtvss

SCOPe Domain Coordinates for d2r0lh1:

Click to download the PDB-style file with coordinates for d2r0lh1.
(The format of our PDB-style files is described here.)

Timeline for d2r0lh1: