SCOPe 2.03: Domain d2r0kh1: 2r0k H:1-113

Lineage for d2r0kh1 (2r0k H:1-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Synthetic construct [TaxId:32630] [158862] (3 PDB entries)

8. Domain d2r0kh1: 2r0k H:1-113 [151500]
   Other proteins in same PDB: d2r0kh2
   automatically matched to d1uj3b1

Details for d2r0kh1

PDB Entry: 2r0k, 3.51 Å

PDB Description: protease domain of hgfa with inhibitor fab58

PDB Compounds: (H:) antibody heavy chain of Fab58, Fab portion only

SCOPe Domain Sequences for d2r0kh1:

Sequence; same for both SEQRES and ATOM records:

>d2r0kh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Synthetic construct [TaxId: 32630]}
evqlvesggglvqpggslrlscaasgftitgsaihwvrqapgkglewvaiinpnggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarsarfsfdywgqgtlvtvss

Timeline for d2r0kh1:

• d2r0kh1 first appeared in SCOP 1.75
  
• d2r0kh1 appears in SCOPe 2.02
  
• d2r0kh1 appears in SCOPe 2.04
  
• d2r0kh1 appears in the current release, SCOPe 2.08