Lineage for d2fal__ (2fal -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350084Protein Myoglobin [46469] (9 species)
  7. 350149Species Sea hare (Aplysia limacina) [TaxId:6502] [46471] (7 PDB entries)
  8. 350151Domain d2fal__: 2fal - [15150]
    complexed with hem

Details for d2fal__

PDB Entry: 2fal (more details), 1.8 Å

PDB Description: x-ray crystal structure of ferric aplysia limacina myoglobin in different liganded states

SCOP Domain Sequences for d2fal__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fal__ a.1.1.2 (-) Myoglobin {Sea hare (Aplysia limacina)}
slsaaeadlagkswapvfanknangldflvalfekfpdsanffadfkgksvadikaspkl
rdvssriftrlnefvnnaanagkmsamlsqfakehvgfgvgsaqfenvrsmfpgfvasva
appagadaawtklfgliidalkaaga

SCOP Domain Coordinates for d2fal__:

Click to download the PDB-style file with coordinates for d2fal__.
(The format of our PDB-style files is described here.)

Timeline for d2fal__: