Lineage for d2r0db1 (2r0d B:65-252)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501140Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1501141Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 1501149Protein Cytohesin-1/b2-1 [48429] (2 species)
  7. 1501152Species Mouse (Mus musculus) [TaxId:10090] [158767] (2 PDB entries)
  8. 1501156Domain d2r0db1: 2r0d B:65-252 [151498]
    Other proteins in same PDB: d2r0da2, d2r0db2
    automatically matched to d1bc9a_
    complexed with 4ip, peg, so4

Details for d2r0db1

PDB Entry: 2r0d (more details), 2.04 Å

PDB Description: crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
PDB Compounds: (B:) Cytohesin-3

SCOPe Domain Sequences for d2r0db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r0db1 a.118.3.1 (B:65-252) Cytohesin-1/b2-1 {Mouse (Mus musculus) [TaxId: 10090]}
qrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnktvigdylgerd
dfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafasryclcnpgvf
qstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpeellrnlyesik
nepfkipe

SCOPe Domain Coordinates for d2r0db1:

Click to download the PDB-style file with coordinates for d2r0db1.
(The format of our PDB-style files is described here.)

Timeline for d2r0db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r0db2