SCOP 1.75: Domain d2r0db1: 2r0d B:65-252

Lineage for d2r0db1 (2r0d B:65-252)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (1 family)

5. Family a.118.3.1: Sec7 domain [48426] (5 proteins)
   Pfam PF01369

6. Protein Cytohesin-1/b2-1 [48429] (2 species)

7. Species Mus musculus [TaxId:10090] [158767] (2 PDB entries)

8. Domain d2r0db1: 2r0d B:65-252 [151498]
   Other proteins in same PDB: d2r0da2, d2r0db2
   automatically matched to d1bc9a_
   complexed with 4ip, peg, so4; mutant

Details for d2r0db1

PDB Entry: 2r0d, 2.04 Å

PDB Description: crystal structure of autoinhibited form of grp1 arf gtpase exchange factor

PDB Compounds: (B:) Cytohesin-3

SCOP Domain Sequences for d2r0db1:

Sequence; same for both SEQRES and ATOM records:

>d2r0db1 a.118.3.1 (B:65-252) Cytohesin-1/b2-1 {Mus musculus [TaxId: 10090]}
qrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnktvigdylgerd
dfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafasryclcnpgvf
qstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpeellrnlyesik
nepfkipe

Timeline for d2r0db1:

• d2r0db1 is new in SCOP 1.75
  
• d2r0db1 appears in SCOPe 2.01
  
• d2r0db1 appears in the current release, SCOPe 2.08