Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (13 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins) Pfam PF00169 |
Protein Grp1 [50751] (1 species) ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog |
Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries) |
Domain d2r0da2: 2r0d A:266-391 [151497] Other proteins in same PDB: d2r0da1, d2r0db1 automatically matched to d1fhwb_ complexed with 4ip, peg, so4; mutant |
PDB Entry: 2r0d (more details), 2.04 Å
SCOP Domain Sequences for d2r0da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r0da2 b.55.1.1 (A:266-391) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy dmlatr
Timeline for d2r0da2: