Class b: All beta proteins [48724] (180 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Grp1 [50751] (1 species) ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog |
Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries) |
Domain d2r09b2: 2r09 B:266-391 [151495] Other proteins in same PDB: d2r09a1, d2r09a3, d2r09b1, d2r09b3 automatically matched to d1fhwb_ complexed with 4ip, pe5, pge, so4 |
PDB Entry: 2r09 (more details), 1.9 Å
SCOPe Domain Sequences for d2r09b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r09b2 b.55.1.1 (B:266-391) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy dmlatr
Timeline for d2r09b2: