SCOP 1.75: Domain d2r09a2: 2r09 A:266-391

Lineage for d2r09a2 (2r09 A:266-391)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
   Pfam PF00169

6. Protein Grp1 [50751] (1 species)
   ARF1 Guanine nucleotide exchange factor and integrin binding protein homolog

7. Species Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries)

8. Domain d2r09a2: 2r09 A:266-391 [151493]
   Other proteins in same PDB: d2r09a1, d2r09b1
   automatically matched to d1fhwb_
   complexed with 4ip, pe5, pge, so4; mutant

Details for d2r09a2

PDB Entry: 2r09, 1.9 Å

PDB Description: crystal structure of autoinhibited form of grp1 arf gtpase exchange factor

PDB Compounds: (A:) Cytohesin-3

SCOP Domain Sequences for d2r09a2:

Sequence; same for both SEQRES and ATOM records:

>d2r09a2 b.55.1.1 (A:266-391) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn
cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy
dmlatr

Timeline for d2r09a2:

• d2r09a2 is new in SCOP 1.75
  
• d2r09a2 appears in SCOPe 2.01
  
• d2r09a2 appears in the current release, SCOPe 2.08