Lineage for d2r09a1 (2r09 A:65-252)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1095602Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1095987Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 1095988Family a.118.3.1: Sec7 domain [48426] (6 proteins)
    Pfam PF01369
  6. 1095996Protein Cytohesin-1/b2-1 [48429] (2 species)
  7. 1095999Species Mouse (Mus musculus) [TaxId:10090] [158767] (2 PDB entries)
  8. 1096000Domain d2r09a1: 2r09 A:65-252 [151492]
    Other proteins in same PDB: d2r09a2, d2r09b2
    automatically matched to d1bc9a_
    complexed with 4ip, pe5, pge, so4

Details for d2r09a1

PDB Entry: 2r09 (more details), 1.9 Å

PDB Description: crystal structure of autoinhibited form of grp1 arf gtpase exchange factor
PDB Compounds: (A:) Cytohesin-3

SCOPe Domain Sequences for d2r09a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r09a1 a.118.3.1 (A:65-252) Cytohesin-1/b2-1 {Mouse (Mus musculus) [TaxId: 10090]}
qrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnktvigdylgerd
dfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafasryclcnpgvf
qstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpeellrnlyesik
nepfkipe

SCOPe Domain Coordinates for d2r09a1:

Click to download the PDB-style file with coordinates for d2r09a1.
(The format of our PDB-style files is described here.)

Timeline for d2r09a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2r09a2