Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.3: Sec7 domain [48425] (2 families) |
Family a.118.3.1: Sec7 domain [48426] (6 proteins) Pfam PF01369 |
Protein Cytohesin-1/b2-1 [48429] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [158767] (2 PDB entries) |
Domain d2r09a1: 2r09 A:63-252 [151492] Other proteins in same PDB: d2r09a2, d2r09a3, d2r09b2, d2r09b3 automatically matched to d1bc9a_ complexed with 4ip, pe5, pge, so4 |
PDB Entry: 2r09 (more details), 1.9 Å
SCOPe Domain Sequences for d2r09a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r09a1 a.118.3.1 (A:63-252) Cytohesin-1/b2-1 {Mouse (Mus musculus) [TaxId: 10090]} ttqrnaqiamgrkkfnmdpkkgiqfliendllqsspedvaqflykgeglnktvigdylge rddfnikvlqafvelhefadlnlvqalrqflwsfrlpgeaqkidrmmeafasryclcnpg vfqstdtcyvlsfaiimlntslhnhnvrdkptaerfitmnrgineggdlpeellrnlyes iknepfkipe
Timeline for d2r09a1: