SCOPe 2.06: Domain d2qzpb2: 2qzp B:322-581

Lineage for d2qzpb2 (2qzp B:322-581)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein)
   closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497)
   automatically mapped to Pfam PF12697

6. Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [117713] (10 PDB entries)
   Uniprot Q9YBQ2

8. Domain d2qzpb2: 2qzp B:322-581 [151490]
   Other proteins in same PDB: d2qzpa1, d2qzpb1
   automatically matched to d1ve6a2
   mutant

Details for d2qzpb2

PDB Entry: 2qzp, 2.7 Å

PDB Description: Crystal structure of mutation of an acylptide hydrolase/esterase from Aeropyrum pernix K1

PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d2qzpb2:

Sequence; same for both SEQRES and ATOM records:

>d2qzpb2 c.69.1.33 (B:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}
lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvhggpfaedsdswdtf
aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi
mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr
srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm
edavkillpavfflatqrer

Timeline for d2qzpb2:

• d2qzpb2 first appeared in SCOP 1.75
  
• d2qzpb2 appears in SCOPe 2.05
  
• d2qzpb2 appears in SCOPe 2.07
  
• d2qzpb2 appears in the current release, SCOPe 2.08