Lineage for d2qzpb1 (2qzp B:22-321)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809416Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2809457Family b.69.7.2: Acylamino-acid-releasing enzyme, N-terminal donain [117286] (1 protein)
  6. 2809458Protein Acylamino-acid-releasing enzyme, N-terminal donain [117287] (1 species)
  7. 2809459Species Aeropyrum pernix [TaxId:56636] [117288] (10 PDB entries)
    Uniprot Q9YBQ2
  8. 2809483Domain d2qzpb1: 2qzp B:22-321 [151489]
    Other proteins in same PDB: d2qzpa2, d2qzpb2
    automatically matched to d1ve6a1
    mutant

Details for d2qzpb1

PDB Entry: 2qzp (more details), 2.7 Å

PDB Description: Crystal structure of mutation of an acylptide hydrolase/esterase from Aeropyrum pernix K1
PDB Compounds: (B:) Acylamino-acid-releasing enzyme

SCOPe Domain Sequences for d2qzpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzpb1 b.69.7.2 (B:22-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]}
vekyslqgvvdgdkllvvgfsegsvnaylydggetvklnrepinsvldphygvgrvilvr
dvskgaeqhalfkvntsrpgeeqrleavkpmrilsgvdtgeavvftgatedrvalyaldg
gglrelarlpgfgfvsdirgdliaglgffgggrvslftsnlssgglrvfdsgegsfssas
ispgmkvtagletarearlvtvdprdgsvedlelpskdfssyrptaitwlgylpdgrlav
varregrsavfidgerveapqgnhgrvvlwrgklvtshtslstpprivslpsgepllegg

SCOPe Domain Coordinates for d2qzpb1:

Click to download the PDB-style file with coordinates for d2qzpb1.
(The format of our PDB-style files is described here.)

Timeline for d2qzpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qzpb2