Lineage for d2qzgc1 (2qzg C:4-90)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767775Superfamily a.29.14: Ta0600-like [158436] (1 family) (S)
  5. 767776Family a.29.14.1: Ta0600-like [158437] (2 proteins)
    Pfam PF03685; UPF0147
  6. 767777Protein Uncharacterized protein MMP1188 [158438] (1 species)
  7. 767778Species Methanococcus maripaludis [TaxId:39152] [158439] (1 PDB entry)
    Uniprot Q6LY05 4-91
  8. 767781Domain d2qzgc1: 2qzg C:4-90 [151484]
    automatically matched to 2QZG A:4-91

Details for d2qzgc1

PDB Entry: 2qzg (more details), 2.09 Å

PDB Description: Crystal structure of unknown function protein MMP1188
PDB Compounds: (C:) Conserved uncharacterized archaeal protein

SCOP Domain Sequences for d2qzgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzgc1 a.29.14.1 (C:4-90) Uncharacterized protein MMP1188 {Methanococcus maripaludis [TaxId: 39152]}
akklspadklknissmleeivedttvprniraaadnaknalhneeqelivrsataiqyld
disedpnmpihtrtqiwgivseletik

SCOP Domain Coordinates for d2qzgc1:

Click to download the PDB-style file with coordinates for d2qzgc1.
(The format of our PDB-style files is described here.)

Timeline for d2qzgc1: