Lineage for d2qzgc_ (2qzg C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2709006Superfamily a.29.14: Ta0600-like [158436] (1 family) (S)
    automatically mapped to Pfam PF03685
  5. 2709007Family a.29.14.1: Ta0600-like [158437] (2 proteins)
    Pfam PF03685; UPF0147
  6. 2709008Protein Uncharacterized protein MMP1188 [158438] (1 species)
  7. 2709009Species Methanococcus maripaludis [TaxId:39152] [158439] (1 PDB entry)
    Uniprot Q6LY05 4-91
  8. 2709012Domain d2qzgc_: 2qzg C: [151484]
    automated match to d2qzga1

Details for d2qzgc_

PDB Entry: 2qzg (more details), 2.09 Å

PDB Description: Crystal structure of unknown function protein MMP1188
PDB Compounds: (C:) Conserved uncharacterized archaeal protein

SCOPe Domain Sequences for d2qzgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qzgc_ a.29.14.1 (C:) Uncharacterized protein MMP1188 {Methanococcus maripaludis [TaxId: 39152]}
fsakklspadklknissmleeivedttvprniraaadnaknalhneeqelivrsataiqy
lddisedpnmpihtrtqiwgivseletik

SCOPe Domain Coordinates for d2qzgc_:

Click to download the PDB-style file with coordinates for d2qzgc_.
(The format of our PDB-style files is described here.)

Timeline for d2qzgc_: