Class g: Small proteins [56992] (90 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90173] (18 PDB entries) |
Domain d2qzfa1: 2qzf A:1001-1062 [151481] automatically matched to d1ojva1 |
PDB Entry: 2qzf (more details)
SCOP Domain Sequences for d2qzfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qzfa1 g.18.1.1 (A:1001-1062) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} mqdcglppdvpnaqpalegrtsfpedtvitykceesfvkipgekdsviclkgsqwsdiee fc
Timeline for d2qzfa1: