SCOPe 2.08: Domain d2qzda1: 2qzd A:1191-1253

Lineage for d2qzda1 (2qzd A:1191-1253)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement decay-accelerating factor (Daf, CD55) [90172] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90173] (19 PDB entries)

8. Domain d2qzda1: 2qzd A:1191-1253 [151480]
   Other proteins in same PDB: d2qzda2
   automatically matched to d1ojva4

Details for d2qzda1

PDB Entry: 2qzd, 14 Å

PDB Description: fitted structure of scr4 of daf into cryoem density

PDB Compounds: (A:) complement decay-accelerating factor

SCOPe Domain Sequences for d2qzda1:

Sequence; same for both SEQRES and ATOM records:

>d2qzda1 g.18.1.1 (A:1191-1253) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]}
iycpappqidngiiqgerdhygyrqsvtyacnkgftmigehsiyctvnndegewsgpppe
crg

Timeline for d2qzda1:

• d2qzda1 first appeared in SCOP 1.75
  
• d2qzda1 appears in SCOPe 2.07