SCOPe 2.08: Domain d1f6ha_: 1f6h A:

Lineage for d1f6ha_ (1f6h A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
   Uniprot P02185

8. Domain d1f6ha_: 1f6h A: [15148]
   complexed with hem

Details for d1f6ha_

PDB Entry: 1f6h

PDB Description: combined rietveld and stereochemical restraint refinement of a protein

PDB Compounds: (A:) myoglobin (met)

SCOPe Domain Sequences for d1f6ha_:

Sequence; same for both SEQRES and ATOM records:

>d1f6ha_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1f6ha_:

• d1f6ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1f6ha_ appears in SCOPe 2.07