![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
![]() | Protein Phosphatidylethanolamine binding protein, PEBP [49779] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49780] (3 PDB entries) |
![]() | Domain d2qyqa_: 2qyq A: [151479] automated match to d1bd9b_ complexed with ptr |
PDB Entry: 2qyq (more details), 1.95 Å
SCOPe Domain Sequences for d2qyqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qyqa_ b.17.1.1 (A:) Phosphatidylethanolamine binding protein, PEBP {Human (Homo sapiens) [TaxId: 9606]} mpvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdglds gklytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhry vwlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkl yeqlsg
Timeline for d2qyqa_: